(data stored in ACNUC7421 zone)

EMBL: CP001658.PE395

CP001658.PE395       Location/Qualifiers
FT   CDS             complement(466929..468260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00388"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00388"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23416"
FT                   /protein_id="ACT23416.1"
FT                   /translation="MDFGALPPEINSARIYSGPGSRPLMQAAAAWQRLANELTATAASY
FT                   SSVISGLTGDDWLGPSALSMAAAAVPYVAWMRATAASAEQAAAQAVAAANAYESAYAAT
FT                   VPPTVIAANRRTMLSLVKTNVFGQNTPAIATSEAQYGEMWAQDIVAMEGYAGASAAASQ
FT                   LPPFTPPPATTSGAGSLSDAAATAAQAVVPAAAATDVSLLPTLQSFLPPPFDAIPNPIE
FT                   DLDVLVAAAVAVAAGSLGVSAAQLGEIYRHDVVDEAQKAPHCPAESDQTPAGAAGDGDL
FT                   PEVGGRVTSPPQPPVAALTGYSANIGGLSVPHSWNLPPAVRQVAAMFPGATPMYMTGSS
FT                   DGSYAGLAAAGLAGTGLAGLAARGGSAPTPAAAAPAGAGGAGPAATRPAAQQTPAVPAA
FT                   AAGSAIPGLPPGLPPGVVANLAATLAAIPGATIIVVPPSPNANQ"
     MDFGALPPEI NSARIYSGPG SRPLMQAAAA WQRLANELTA TAASYSSVIS GLTGDDWLGP        60
     SALSMAAAAV PYVAWMRATA ASAEQAAAQA VAAANAYESA YAATVPPTVI AANRRTMLSL       120
     VKTNVFGQNT PAIATSEAQY GEMWAQDIVA MEGYAGASAA ASQLPPFTPP PATTSGAGSL       180
     SDAAATAAQA VVPAAAATDV SLLPTLQSFL PPPFDAIPNP IEDLDVLVAA AVAVAAGSLG       240
     VSAAQLGEIY RHDVVDEAQK APHCPAESDQ TPAGAAGDGD LPEVGGRVTS PPQPPVAALT       300
     GYSANIGGLS VPHSWNLPPA VRQVAAMFPG ATPMYMTGSS DGSYAGLAAA GLAGTGLAGL       360
     AARGGSAPTP AAAAPAGAGG AGPAATRPAA QQTPAVPAAA AGSAIPGLPP GLPPGVVANL       420
     AATLAAIPGA TIIVVPPSPN ANQ                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page