(data stored in ACNUC7421 zone)

EMBL: CP001658.PE4

CP001658.PE4         Location/Qualifiers
FT   CDS             4536..5099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00004"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23025"
FT                   /protein_id="ACT23025.1"
FT                   /translation="MTGSVDRPDQNRGERSMKSPGLDLVRRTLDEARAAARARGQDAGR
FT                   GRVASVASGRVAGRRRSWSGPGPDIRDPQPLGKAARELAKKRGWSVRVAEGMVLGQWSA
FT                   VVGHQIAEHARPTALNDGVLSVIAESTAWATQLRIMQAQLLAKIAAAVGNDVVRSLKIT
FT                   GPAAPSWRKGPRHIAGRGPRDTYG"
     MTGSVDRPDQ NRGERSMKSP GLDLVRRTLD EARAAARARG QDAGRGRVAS VASGRVAGRR        60
     RSWSGPGPDI RDPQPLGKAA RELAKKRGWS VRVAEGMVLG QWSAVVGHQI AEHARPTALN       120
     DGVLSVIAES TAWATQLRIM QAQLLAKIAA AVGNDVVRSL KITGPAAPSW RKGPRHIAGR       180
     GPRDTYG                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page