(data stored in ACNUC7421 zone)

EMBL: CP001658.PE40

CP001658.PE40        Location/Qualifiers
FT   CDS             complement(42536..43468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00039"
FT                   /product="secreted proline rich protein mtc28"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23061"
FT                   /protein_id="ACT23061.1"
FT                   /translation="MIQIARTWRVFAGGMATGFIGVVLVTAGKASADPLLPPPPIPAPV
FT                   SAPATVPPVQNLTALPGGSSNRFSPAPAPAPIASPIPVGAPGSTAVPPLPPPVTPAISG
FT                   TLRDHLREKGVKLEAQRPHGFKALDITLPMPPRWTQVPDPNVPDAFVVIADRLGNSVYT
FT                   SNAQLVVYRLIGDFDPAEAITHGYIDSQKLLAWQTTNASMANFDGFPSSIIEGTYREND
FT                   MTLNTSRRHVIATSGADKYLVSLSVTTALSQAVTDGPATDAIVNGFQVVAHAAPAQAPA
FT                   PAPGSAPVGLPGQAPGYPPAGTLTPVPPR"
     MIQIARTWRV FAGGMATGFI GVVLVTAGKA SADPLLPPPP IPAPVSAPAT VPPVQNLTAL        60
     PGGSSNRFSP APAPAPIASP IPVGAPGSTA VPPLPPPVTP AISGTLRDHL REKGVKLEAQ       120
     RPHGFKALDI TLPMPPRWTQ VPDPNVPDAF VVIADRLGNS VYTSNAQLVV YRLIGDFDPA       180
     EAITHGYIDS QKLLAWQTTN ASMANFDGFP SSIIEGTYRE NDMTLNTSRR HVIATSGADK       240
     YLVSLSVTTA LSQAVTDGPA TDAIVNGFQV VAHAAPAQAP APAPGSAPVG LPGQAPGYPP       300
     AGTLTPVPPR                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page