(data stored in ACNUC7421 zone)

EMBL: CP001658.PE401

CP001658.PE401       Location/Qualifiers
FT   CDS             complement(474381..475100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00394"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00394"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23422"
FT                   /protein_id="ACT23422.1"
FT                   /translation="MTEPRPVFAVVISAGLSAIPMVGGPLQTVFDAIEERTRHRAETTT
FT                   REICESVGGADTVLSRIDKNPELEPLLSQAIEAATRTSMEAKRRLLAQAAAAALEDDQK
FT                   VEPASLIVATLSQLEPVHIHALVRLAKAAKSSPDQDEIQRREVMRAASKVEPVPVLAAL
FT                   IQTGVAIATTTVWHGNGTGTPAEESGHILIHDVSDFGHRLLAYLRAADAGAELLILPSG
FT                   GSAPTGDHPTPHPSTSR"
     MTEPRPVFAV VISAGLSAIP MVGGPLQTVF DAIEERTRHR AETTTREICE SVGGADTVLS        60
     RIDKNPELEP LLSQAIEAAT RTSMEAKRRL LAQAAAAALE DDQKVEPASL IVATLSQLEP       120
     VHIHALVRLA KAAKSSPDQD EIQRREVMRA ASKVEPVPVL AALIQTGVAI ATTTVWHGNG       180
     TGTPAEESGH ILIHDVSDFG HRLLAYLRAA DAGAELLILP SGGSAPTGDH PTPHPSTSR        239
//

If you have problems or comments...

PBIL Back to PBIL home page