(data stored in ACNUC7421 zone)

EMBL: CP001658.PE402

CP001658.PE402       Location/Qualifiers
FT   CDS             475199..475603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23423"
FT                   /protein_id="ACT23423.1"
FT                   /translation="MDWMPLGDYETFRHWSGKPRAWGPQESGWRAWFGGKIVDGLCEVL
FT                   DEHLAVRRRGVPAAIGCVPWLSSEAVAETLLALSAFCVVIDKGTSFPSRLRNPDKGFPN
FT                   VALLRLRDMAPSEHGSRCSSARGRLCLSMS"
     MDWMPLGDYE TFRHWSGKPR AWGPQESGWR AWFGGKIVDG LCEVLDEHLA VRRRGVPAAI        60
     GCVPWLSSEA VAETLLALSA FCVVIDKGTS FPSRLRNPDK GFPNVALLRL RDMAPSEHGS       120
     RCSSARGRLC LSMS                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page