(data stored in ACNUC7421 zone)

EMBL: CP001658.PE404

CP001658.PE404       Location/Qualifiers
FT   CDS             476075..476443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00397"
FT                   /product="13E12 repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23425"
FT                   /protein_id="ACT23425.1"
FT                   /translation="MLATFWGWRAQQLPDGTVIWTLPGDQTYVTTPGSALLFPALCTPT
FT                   GDPPRPDPARADRRGQRTAMMPRRASTRAQNRAHYIAAERHRNHQARRIAHVVTQTATT
FT                   APETNGPPPDPDDDPPPF"
     MLATFWGWRA QQLPDGTVIW TLPGDQTYVT TPGSALLFPA LCTPTGDPPR PDPARADRRG        60
     QRTAMMPRRA STRAQNRAHY IAAERHRNHQ ARRIAHVVTQ TATTAPETNG PPPDPDDDPP       120
     PF                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page