(data stored in ACNUC7421 zone)

EMBL: CP001658.PE405

CP001658.PE405       Location/Qualifiers
FT   CDS             476653..476901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00398"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23426"
FT                   /protein_id="ACT23426.1"
FT                   /translation="MHALRLVGLAILTAIAPIAVLIGSSPAHADTDIGQPCSPEGAKLW
FT                   GNPGPIYCERTADGQLQWVSIPAWALCVAFCDRPGGP"
     MHALRLVGLA ILTAIAPIAV LIGSSPAHAD TDIGQPCSPE GAKLWGNPGP IYCERTADGQ        60
     LQWVSIPAWA LCVAFCDRPG GP                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page