(data stored in ACNUC7421 zone)

EMBL: CP001658.PE409

CP001658.PE409       Location/Qualifiers
FT   CDS             480048..480419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00402"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00402"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23430"
FT                   /protein_id="ACT23430.1"
FT                   /translation="MRPRRALAGLAADVVAVLVFCAVGRRSHAEGLSVTGLAATAWPFL
FT                   TGTGIGWVLARGWRRPTALAPTGVIVWLCTIVVGMVLRKVSSAGVAASFVVVASAVTAV
FT                   LLLGWRAAVALMAPHRADG"
     MRPRRALAGL AADVVAVLVF CAVGRRSHAE GLSVTGLAAT AWPFLTGTGI GWVLARGWRR        60
     PTALAPTGVI VWLCTIVVGM VLRKVSSAGV AASFVVVASA VTAVLLLGWR AAVALMAPHR       120
     ADG                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page