(data stored in ACNUC7421 zone)

EMBL: CP001658.PE414

CP001658.PE414       Location/Qualifiers
FT   CDS             complement(490146..490964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00407"
FT                   /product="beta lactamase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00407"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23435"
FT                   /protein_id="ACT23435.1"
FT                   /translation="MVATRGTRLAALALAPRLAGMAELVQITDKVHLARGHAVNWVLVT
FT                   DDTGVLLIDAGYPGDRAEVLASLNKLGYTPGDVRAIVLTHAHIDHLGSAIWFAREHSTP
FT                   VYCHAEEVGHAKREYRENASVFDVALRSWRPRVAVWGIHLLRRGGLTGDGIPTAQPLTA
FT                   EAAAGLPGQPMAIFTPGHTSGHCSYVVDGVLASGDALITGHPMLRHRGPQLLPAVFSHS
FT                   QQNSIRSLAALALLETNILAPGHGELWHGPIRKATDEALERAQKSNHVFR"
     MVATRGTRLA ALALAPRLAG MAELVQITDK VHLARGHAVN WVLVTDDTGV LLIDAGYPGD        60
     RAEVLASLNK LGYTPGDVRA IVLTHAHIDH LGSAIWFARE HSTPVYCHAE EVGHAKREYR       120
     ENASVFDVAL RSWRPRVAVW GIHLLRRGGL TGDGIPTAQP LTAEAAAGLP GQPMAIFTPG       180
     HTSGHCSYVV DGVLASGDAL ITGHPMLRHR GPQLLPAVFS HSQQNSIRSL AALALLETNI       240
     LAPGHGELWH GPIRKATDEA LERAQKSNHV FR                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page