(data stored in ACNUC7421 zone)

EMBL: CP001658.PE421

CP001658.PE421       Location/Qualifiers
FT   CDS             499972..500625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00414"
FT                   /product="mutator protein mutT3"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23442"
FT                   /protein_id="ACT23442.1"
FT                   /translation="MPSCPPAYSEQVRGDGDGWVVSDSGVAYWGRYGAAGLLLRAPRPD
FT                   GTPAVLLQHRALWSHQGGTWGLPGGARDSHETPEQTAVRESSEEAGLSAERLEVRATVV
FT                   TAEVCGVDDTHWTYTTVVADAGELLDTVPNRESAELRWVAENEVADLPLHPGFAASWQR
FT                   LRTAPATVPLARCDERRQRLPRTIQIEAGVFLWCTPGDADQAPSPLGRRISSLL"
     MPSCPPAYSE QVRGDGDGWV VSDSGVAYWG RYGAAGLLLR APRPDGTPAV LLQHRALWSH        60
     QGGTWGLPGG ARDSHETPEQ TAVRESSEEA GLSAERLEVR ATVVTAEVCG VDDTHWTYTT       120
     VVADAGELLD TVPNRESAEL RWVAENEVAD LPLHPGFAAS WQRLRTAPAT VPLARCDERR       180
     QRLPRTIQIE AGVFLWCTPG DADQAPSPLG RRISSLL                                217
//

If you have problems or comments...

PBIL Back to PBIL home page