(data stored in ACNUC7421 zone)

EMBL: CP001658.PE426

CP001658.PE426       Location/Qualifiers
FT   CDS             503405..503557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03984"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03984"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23447"
FT                   /protein_id="ACT23447.1"
FT                   /translation="MRAARYRSDCPGCGSLRIQCSLIHADLLAAADYNVVGLAAAVLSV
FT                   WAYLA"
     MRAARYRSDC PGCGSLRIQC SLIHADLLAA ADYNVVGLAA AVLSVWAYLA                   50
//

If you have problems or comments...

PBIL Back to PBIL home page