(data stored in ACNUC7421 zone)

EMBL: CP001658.PE429

CP001658.PE429       Location/Qualifiers
FT   CDS             complement(506820..507230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00421"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23450"
FT                   /protein_id="ACT23450.1"
FT                   /translation="MRLHDASAAAPESRMHIARHGEAVNRRQMFIGITGLLLAVIGLMA
FT                   LWFPVYLDQYDAYGIKVTCGSGWRSNLTQALYADGNDNTQALVTRCDTALLVRRAWAIP
FT                   SVALGWLLVTGFLVMWVHNDQHQGQSYPGYRA"
     MRLHDASAAA PESRMHIARH GEAVNRRQMF IGITGLLLAV IGLMALWFPV YLDQYDAYGI        60
     KVTCGSGWRS NLTQALYADG NDNTQALVTR CDTALLVRRA WAIPSVALGW LLVTGFLVMW       120
     VHNDQHQGQS YPGYRA                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page