(data stored in ACNUC7421 zone)

EMBL: CP001658.PE431

CP001658.PE431       Location/Qualifiers
FT   CDS             complement(508017..508844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00423"
FT                   /product="phosphomethylpyrimidine kinase thiD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23452"
FT                   /protein_id="ACT23452.1"
FT                   /translation="MNYLPLAPPGMTPPRVLSIAGSDSGGGAGIQADMRTMALLGVHAC
FT                   VAVTAVTVQNTLGVKDIHEVPNDVVAGQIEAVVTDIGVQAAKTGMLASSRIVATVAATW
FT                   RRLELSVPLVVDPVCASMHGDPLLAPSALDSLRGQLFPLATLLTPNLDEARLLVDIEVV
FT                   DAESQRAAAKALHALGPQWVLVKGGHLRSSDGSCDLLYDGVSCYQFDAQRLPTGDDHGG
FT                   GDTLATAIAAALAHGFTVPDAVDFGKRWVTECLRAAYPLGRGHGPVSPLFRLS"
     MNYLPLAPPG MTPPRVLSIA GSDSGGGAGI QADMRTMALL GVHACVAVTA VTVQNTLGVK        60
     DIHEVPNDVV AGQIEAVVTD IGVQAAKTGM LASSRIVATV AATWRRLELS VPLVVDPVCA       120
     SMHGDPLLAP SALDSLRGQL FPLATLLTPN LDEARLLVDI EVVDAESQRA AAKALHALGP       180
     QWVLVKGGHL RSSDGSCDLL YDGVSCYQFD AQRLPTGDDH GGGDTLATAI AAALAHGFTV       240
     PDAVDFGKRW VTECLRAAYP LGRGHGPVSP LFRLS                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page