(data stored in ACNUC7421 zone)

EMBL: CP001658.PE435

CP001658.PE435       Location/Qualifiers
FT   CDS             complement(515632..516207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00427"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00427"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23456"
FT                   /protein_id="ACT23456.1"
FT                   /translation="MAGLHFESAEQKSRQRCECRVRVNECRTVAKPFVNECSLGQGVIM
FT                   SVVGGTVRTVGRTVSGAATATTAAAGAVGGAAVSGIVGGVTGAAKGIQKGLSSGSKSTA
FT                   AAALAIGAIGVAGLVDWPILLAVGGGALLLRKLNRTPEVAAPPVKAKLAPVPDKPAAAK
FT                   EAPAKASKTTARKTSGRRAGTAELRSTN"
     MAGLHFESAE QKSRQRCECR VRVNECRTVA KPFVNECSLG QGVIMSVVGG TVRTVGRTVS        60
     GAATATTAAA GAVGGAAVSG IVGGVTGAAK GIQKGLSSGS KSTAAAALAI GAIGVAGLVD       120
     WPILLAVGGG ALLLRKLNRT PEVAAPPVKA KLAPVPDKPA AAKEAPAKAS KTTARKTSGR       180
     RAGTAELRST N                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page