(data stored in ACNUC7421 zone)

EMBL: CP001658.PE438

CP001658.PE438       Location/Qualifiers
FT   CDS             complement(518062..518655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00430"
FT                   /product="polypeptide deformylase def"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23459"
FT                   /protein_id="ACT23459.1"
FT                   /translation="MAVVPIRIVGDPVLHTATTPVTVAADGSLPADLAQLIATMYDTMD
FT                   AANGVGLAANQIGCSLRLFVYDCAADRAMTARRRGVVINPVLETSEIPETMPDPDTDDE
FT                   GCLSVPGESFPTGRAKWARVTGLDADGSPVSIEGTGLFARMLQHETGHLDGFLYLDRLI
FT                   GRYARNAKRAVKSHGWGVPGLSWLPGEDPDPFGH"
     MAVVPIRIVG DPVLHTATTP VTVAADGSLP ADLAQLIATM YDTMDAANGV GLAANQIGCS        60
     LRLFVYDCAA DRAMTARRRG VVINPVLETS EIPETMPDPD TDDEGCLSVP GESFPTGRAK       120
     WARVTGLDAD GSPVSIEGTG LFARMLQHET GHLDGFLYLD RLIGRYARNA KRAVKSHGWG       180
     VPGLSWLPGE DPDPFGH                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page