(data stored in ACNUC7421 zone)

EMBL: CP001658.PE440

CP001658.PE440       Location/Qualifiers
FT   CDS             519332..519826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00432"
FT                   /product="tuberculin related peptide"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00432"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23461"
FT                   /protein_id="ACT23461.1"
FT                   /translation="MLVTVGSMNERVPDSSGLPLRAMVMVLLFLGVVFLLLVWQALGSS
FT                   PNSEDDSSAISTMTTTTAAPTSTSVKPAAPRAEVRVYNISGTEGAAARTADRLKAAGFT
FT                   VTDVGNLSLPDVAATTVYYTEVEGERATADAVGRTLGAAVELRLPELSDQPPGVIVVVT
FT                   G"
     MLVTVGSMNE RVPDSSGLPL RAMVMVLLFL GVVFLLLVWQ ALGSSPNSED DSSAISTMTT        60
     TTAAPTSTSV KPAAPRAEVR VYNISGTEGA AARTADRLKA AGFTVTDVGN LSLPDVAATT       120
     VYYTEVEGER ATADAVGRTL GAAVELRLPE LSDQPPGVIV VVTG                        164
//

If you have problems or comments...

PBIL Back to PBIL home page