(data stored in ACNUC7421 zone)

EMBL: CP001658.PE442

CP001658.PE442       Location/Qualifiers
FT   CDS             520583..521713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00434"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00434"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23463"
FT                   /protein_id="ACT23463.1"
FT                   /translation="MPARRSAARIDFAGSPRPTLGVEWEFALVDSQTRDLSNEATAVIA
FT                   EIGENPRVHKELLRNTVEIVSGICECTAEAMQDLRDTLGPARQIVRDRGMELFCAGTHP
FT                   FARWSAQKLTDAPRYAELIKRTQWWGRQMLIWGVHVHVGIRSAHKVMPIMTSLLNYYPH
FT                   LLALSASSPWWGGEDTGYASNRAMMFQQLPTAGLPFHFQRWAEFEGFVYDQKKTGIIDH
FT                   MDEIRWDIRPSPHLGTLEVRICDGVSNLRELGALVALTHCLIVDLDRRLDAGETLPTMP
FT                   PWHVQENKWRAARYGLDAVIILDADSNERLVTDDLADVLTRLEPVAKSLNCADELAAVS
FT                   DIYRDGASYQRQLRVAQQHDGDLRAVVDALVAELVI"
     MPARRSAARI DFAGSPRPTL GVEWEFALVD SQTRDLSNEA TAVIAEIGEN PRVHKELLRN        60
     TVEIVSGICE CTAEAMQDLR DTLGPARQIV RDRGMELFCA GTHPFARWSA QKLTDAPRYA       120
     ELIKRTQWWG RQMLIWGVHV HVGIRSAHKV MPIMTSLLNY YPHLLALSAS SPWWGGEDTG       180
     YASNRAMMFQ QLPTAGLPFH FQRWAEFEGF VYDQKKTGII DHMDEIRWDI RPSPHLGTLE       240
     VRICDGVSNL RELGALVALT HCLIVDLDRR LDAGETLPTM PPWHVQENKW RAARYGLDAV       300
     IILDADSNER LVTDDLADVL TRLEPVAKSL NCADELAAVS DIYRDGASYQ RQLRVAQQHD       360
     GDLRAVVDAL VAELVI                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page