(data stored in ACNUC7421 zone)

EMBL: CP001658.PE452

CP001658.PE452       Location/Qualifiers
FT   CDS             532613..533170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23473"
FT                   /protein_id="ACT23473.1"
FT                   /translation="MQLRVCHLPRNVAGMASTDAAAQELLRDAFTRLIEHVDELTDGLT
FT                   DQLACYRPTPSANSIAWLLWHSARVQDIQVAHVAGVEEVWTRDGWVDRFGLDLPRHDTG
FT                   YGHRPEDVAKVRAPADLLSGYYHAVHKLTLEYIAGMTADELSRVVDTSWNPPVTVSARL
FT                   VSIVDDCAQHLGQAAYLRGIAR"
     MQLRVCHLPR NVAGMASTDA AAQELLRDAF TRLIEHVDEL TDGLTDQLAC YRPTPSANSI        60
     AWLLWHSARV QDIQVAHVAG VEEVWTRDGW VDRFGLDLPR HDTGYGHRPE DVAKVRAPAD       120
     LLSGYYHAVH KLTLEYIAGM TADELSRVVD TSWNPPVTVS ARLVSIVDDC AQHLGQAAYL       180
     RGIAR                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page