(data stored in ACNUC7421 zone)

EMBL: CP001658.PE456

CP001658.PE456       Location/Qualifiers
FT   CDS             complement(534950..535486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00447"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23477"
FT                   /protein_id="ACT23477.1"
FT                   /translation="MNIVVVTSVSALAVAVVHSVAFAIGRRIGRYNVVDVVWGLGFVAV
FT                   AVAAATLGHGDPVRRWLLLALVSTWGLRLSWHMYRKTAGQGEDPRYADLLRGATPVQAL
FT                   RKVFGLQGLLTLFVSFPLQLSAVTGPTPKPLLAVGGVGLAVWLVGITFEAVGDWQLWVF
FT                   KSDPANRGVIMDRGL"
     MNIVVVTSVS ALAVAVVHSV AFAIGRRIGR YNVVDVVWGL GFVAVAVAAA TLGHGDPVRR        60
     WLLLALVSTW GLRLSWHMYR KTAGQGEDPR YADLLRGATP VQALRKVFGL QGLLTLFVSF       120
     PLQLSAVTGP TPKPLLAVGG VGLAVWLVGI TFEAVGDWQL WVFKSDPANR GVIMDRGL         178
//

If you have problems or comments...

PBIL Back to PBIL home page