(data stored in ACNUC7421 zone)

EMBL: CP001658.PE458

CP001658.PE458       Location/Qualifiers
FT   CDS             complement(536763..537428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00449"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23479"
FT                   /protein_id="ACT23479.1"
FT                   /translation="MHHSFAYRSYSWYVDVDNLPQLPWWLRPFARFHADDHFADPFSCP
FT                   PHSSLRDRLDAFFAARGLAVPDGRITALLQARVLGYVFNPLSIFWCHDRDGQLRHVIAE
FT                   VHNTYGGRHAYLLPPADLPVVTAKNFYVSPFHQLAGYYLIRAPRPDRELDVTVTLHRDR
FT                   RQVCPEFTATLRGQRRPATTRQIAMMQIISPLAPMVVAARIRIQGIRLWLRRVPVVPR"
     MHHSFAYRSY SWYVDVDNLP QLPWWLRPFA RFHADDHFAD PFSCPPHSSL RDRLDAFFAA        60
     RGLAVPDGRI TALLQARVLG YVFNPLSIFW CHDRDGQLRH VIAEVHNTYG GRHAYLLPPA       120
     DLPVVTAKNF YVSPFHQLAG YYLIRAPRPD RELDVTVTLH RDRRQVCPEF TATLRGQRRP       180
     ATTRQIAMMQ IISPLAPMVV AARIRIQGIR LWLRRVPVVP R                           221
//

If you have problems or comments...

PBIL Back to PBIL home page