(data stored in ACNUC7421 zone)

EMBL: CP001658.PE459

CP001658.PE459       Location/Qualifiers
FT   CDS             complement(537488..538807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23480"
FT                   /protein_id="ACT23480.1"
FT                   /translation="MQQSLRRSVAVVGSGVAGLTAAYILSGRDRVTLYEADGRLGGHAH
FT                   THYLDNGGGPRGTDVVGVDSAFLVHNDRTYPTLCRLFAELGVATQESEMSMSVRADDIG
FT                   LEYAGALGARGLFACRQSLRPRYLCMLAEILRFHRAAARLLREETDNAEDKPETLEAFL
FT                   SRHHFSQYFVDYFITPLVAAVWSCGGADALRYPARYLFVFLDHHGMLSVFGSPTWRTVT
FT                   GGSANYVQAIAAQLDEVSTRTPVHSLRRLPDGVLVGAGDGPSRRFDAAVVAVHPDQALL
FT                   LLDEPTPAERAVLGAIAYSTNSAQLHTDESVLPRHHRARASWNYLVTPGQHQVVVSYDI
FT                   SRLMRLDGGRRYLVTLGGHDRVDPSSVIAEMTYSHPLYTPESVAAQRLLPTLGDNRVVF
FT                   AGAYHGWGFHEDGAASGLRAARRLGADWPAAIPQEAMVAC"
     MQQSLRRSVA VVGSGVAGLT AAYILSGRDR VTLYEADGRL GGHAHTHYLD NGGGPRGTDV        60
     VGVDSAFLVH NDRTYPTLCR LFAELGVATQ ESEMSMSVRA DDIGLEYAGA LGARGLFACR       120
     QSLRPRYLCM LAEILRFHRA AARLLREETD NAEDKPETLE AFLSRHHFSQ YFVDYFITPL       180
     VAAVWSCGGA DALRYPARYL FVFLDHHGML SVFGSPTWRT VTGGSANYVQ AIAAQLDEVS       240
     TRTPVHSLRR LPDGVLVGAG DGPSRRFDAA VVAVHPDQAL LLLDEPTPAE RAVLGAIAYS       300
     TNSAQLHTDE SVLPRHHRAR ASWNYLVTPG QHQVVVSYDI SRLMRLDGGR RYLVTLGGHD       360
     RVDPSSVIAE MTYSHPLYTP ESVAAQRLLP TLGDNRVVFA GAYHGWGFHE DGAASGLRAA       420
     RRLGADWPAA IPQEAMVAC                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page