(data stored in ACNUC7421 zone)

EMBL: CP001658.PE461

CP001658.PE461       Location/Qualifiers
FT   CDS             complement(541747..542169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00452"
FT                   /product="membrane protein mmpS4"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00452"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23482"
FT                   /protein_id="ACT23482.1"
FT                   /translation="MLMRTWIPLVILVVVIVGGFTVHRIRGFFGSENRPSYSDTNLENS
FT                   KPFNPKHLTYEIFGPPGTVADISYFDVNSEPQRVDGAVLPWSLHITTNDAAVMGNIVAQ
FT                   GNSDSIGCRITVDGKVRAERVSNEVNAYTYCLVKSA"
     MLMRTWIPLV ILVVVIVGGF TVHRIRGFFG SENRPSYSDT NLENSKPFNP KHLTYEIFGP        60
     PGTVADISYF DVNSEPQRVD GAVLPWSLHI TTNDAAVMGN IVAQGNSDSI GCRITVDGKV       120
     RAERVSNEVN AYTYCLVKSA                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page