(data stored in ACNUC7421 zone)

EMBL: CP001658.PE463

CP001658.PE463       Location/Qualifiers
FT   CDS             543433..544989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00454"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00454"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23484"
FT                   /protein_id="ACT23484.1"
FT                   /translation="MTSALIWMASPPEVHSALLSSGPGPGPVLAAATGWSSLGREYAAV
FT                   AEELGALLAAVQAGVWQGPSAESFAAACLPYLSWLTQASADCAAAAARLEAVTAAYAAA
FT                   LVAMPTLAELAANHATHGAMVATNFFGINTIPIAVNEADYVRMWLQAATTMATYQAVAD
FT                   SAVRSIPDSVPPPRILKSNAQSQHSSSNNSGGADPVDDFIAEILKIITGGRVIWDPEAG
FT                   TVNGLPYDAYTNPGTLMWWIARSLELLQDFQEFAKLLFTNPVKAFQFLVDLILFDWPTH
FT                   MLQLATWLAENPQLLVAALTPAISGLGAVSGLAGLTGLVPQPPVVPAPAPDAVVPTVLP
FT                   LAGTATPTTAPASAPAAGAAPGPPAGTATATSASVPTSAGGFPPYLVGSGPGIDFDAGT
FT                   PAGSRRAQPAADNVTAVAAAQVSARHQARRRRRAAAKERGNADEFVDMDSGPAIPPSGE
FT                   RDAWASNSGVGGLGFAGTASNETVAAPAGLTTLADDEFQCGPRMPMLPGAWDLGTWDRG
FT                   D"
     MTSALIWMAS PPEVHSALLS SGPGPGPVLA AATGWSSLGR EYAAVAEELG ALLAAVQAGV        60
     WQGPSAESFA AACLPYLSWL TQASADCAAA AARLEAVTAA YAAALVAMPT LAELAANHAT       120
     HGAMVATNFF GINTIPIAVN EADYVRMWLQ AATTMATYQA VADSAVRSIP DSVPPPRILK       180
     SNAQSQHSSS NNSGGADPVD DFIAEILKII TGGRVIWDPE AGTVNGLPYD AYTNPGTLMW       240
     WIARSLELLQ DFQEFAKLLF TNPVKAFQFL VDLILFDWPT HMLQLATWLA ENPQLLVAAL       300
     TPAISGLGAV SGLAGLTGLV PQPPVVPAPA PDAVVPTVLP LAGTATPTTA PASAPAAGAA       360
     PGPPAGTATA TSASVPTSAG GFPPYLVGSG PGIDFDAGTP AGSRRAQPAA DNVTAVAAAQ       420
     VSARHQARRR RRAAAKERGN ADEFVDMDSG PAIPPSGERD AWASNSGVGG LGFAGTASNE       480
     TVAAPAGLTT LADDEFQCGP RMPMLPGAWD LGTWDRGD                               518
//

If you have problems or comments...

PBIL Back to PBIL home page