(data stored in ACNUC7421 zone)

EMBL: CP001658.PE464

CP001658.PE464       Location/Qualifiers
FT   CDS             complement(544995..545549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23485"
FT                   /protein_id="ACT23485.1"
FT                   /translation="MGPSAAVRRIDSGDQLRNSHIHHPRNSTTYRVPLGLRPCPTSLLV
FT                   AQPPPATRRDTMPLRGRGKHRGPHGLDTGARRMSQAPGNEIPHTLAALDWGGITCQSGA
FT                   GCTNRASYVVHLHAVDECNDPDLDPFGNTVEILCIACLWHVEAKVLLQVGRLTRSPGAF
FT                   CLTCGAPVREPTDIMRDVAAL"
     MGPSAAVRRI DSGDQLRNSH IHHPRNSTTY RVPLGLRPCP TSLLVAQPPP ATRRDTMPLR        60
     GRGKHRGPHG LDTGARRMSQ APGNEIPHTL AALDWGGITC QSGAGCTNRA SYVVHLHAVD       120
     ECNDPDLDPF GNTVEILCIA CLWHVEAKVL LQVGRLTRSP GAFCLTCGAP VREPTDIMRD       180
     VAAL                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page