(data stored in ACNUC7421 zone)

EMBL: CP001658.PE47

CP001658.PE47        Location/Qualifiers
FT   CDS             complement(51288..51830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00046"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23068"
FT                   /protein_id="ACT23068.1"
FT                   /translation="MLELAILGLLIESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRR
FT                   MQADGLIAENAAPAGTPVRRARRVYQLTDKGRRRFGELVADTGPHNYTDDGFGVHLAFF
FT                   NRTPAEARMRILEGRRRQVEERREGLREAVARASSSFDRYTRQLHQLGLESSEREVKWL
FT                   NELIAAERAAPNPAEQT"
     MLELAILGLL IESPMHGYEL RKRLTGLLGA FRAFSYGSLY PALRRMQADG LIAENAAPAG        60
     TPVRRARRVY QLTDKGRRRF GELVADTGPH NYTDDGFGVH LAFFNRTPAE ARMRILEGRR       120
     RQVEERREGL REAVARASSS FDRYTRQLHQ LGLESSEREV KWLNELIAAE RAAPNPAEQT       180
//

If you have problems or comments...

PBIL Back to PBIL home page