(data stored in ACNUC7421 zone)

EMBL: CP001658.PE471

CP001658.PE471       Location/Qualifiers
FT   CDS             551457..551948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23492"
FT                   /protein_id="ACT23492.1"
FT                   /translation="MNAPAGVLITAEAAALLAGLQDRHGPVMFHQSGGCCDGSAPMCYP
FT                   RADFLVGDRDILLGVLDVGEDGVPVWISGPQYQAWKHTQLIIDVVPGRGGGFSLEAPEG
FT                   VRFLSRGRVFSDAEKAMREAAPVITGAAYECGERPLVRGLVVDLDDPDATPGVCRASRR
FT                   "
     MNAPAGVLIT AEAAALLAGL QDRHGPVMFH QSGGCCDGSA PMCYPRADFL VGDRDILLGV        60
     LDVGEDGVPV WISGPQYQAW KHTQLIIDVV PGRGGGFSLE APEGVRFLSR GRVFSDAEKA       120
     MREAAPVITG AAYECGERPL VRGLVVDLDD PDATPGVCRA SRR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page