(data stored in ACNUC7421 zone)

EMBL: CP001658.PE472

CP001658.PE472       Location/Qualifiers
FT   CDS             551969..552247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00462"
FT                   /product="conserved hydrophobic protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00462"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23493"
FT                   /protein_id="ACT23493.1"
FT                   /translation="MIPLPRSWQLTSAMLVGNAIGLLAGVACSVLVHARIRPDIVIAMV
FT                   VGIPSAIGLLVILFSGRRWVTMLGAFILALAPGWFGVLVAIQVASSG"
     MIPLPRSWQL TSAMLVGNAI GLLAGVACSV LVHARIRPDI VIAMVVGIPS AIGLLVILFS        60
     GRRWVTMLGA FILALAPGWF GVLVAIQVAS SG                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page