(data stored in ACNUC7421 zone)

EMBL: CP001658.PE475

CP001658.PE475       Location/Qualifiers
FT   CDS             554275..554568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00465"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23496"
FT                   /protein_id="ACT23496.1"
FT                   /translation="MTRRASTDTPQIIMGAIGGVVTGYILWLAAISVGDGLTTVSQWSR
FT                   VVLLLSVLVAVCGAAGGLRLRSRGKLAWSAFAFSLPIPPVVLTVAVLADIYL"
     MTRRASTDTP QIIMGAIGGV VTGYILWLAA ISVGDGLTTV SQWSRVVLLL SVLVAVCGAA        60
     GGLRLRSRGK LAWSAFAFSL PIPPVVLTVA VLADIYL                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page