(data stored in ACNUC7421 zone)

EMBL: CP001658.PE476

CP001658.PE476       Location/Qualifiers
FT   CDS             complement(554572..555144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00466"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23497"
FT                   /protein_id="ACT23497.1"
FT                   /translation="MTGQNGQVARISPGKFRQLGPVNWLVAKLAARAVGAPQMHLFTTL
FT                   GYRQYLFWTFAIYTGRLLHGRLPGVDTELVILRVAHLRSCEYELQHHRRMARRRGLDAN
FT                   TQATIFAWPDVPDGDGPRKVLSARQQALLQATDELIKDRTITAGTWERLATHLDPRLLI
FT                   EFCLLATQYDAIAATITALAIPPDNPQ"
     MTGQNGQVAR ISPGKFRQLG PVNWLVAKLA ARAVGAPQMH LFTTLGYRQY LFWTFAIYTG        60
     RLLHGRLPGV DTELVILRVA HLRSCEYELQ HHRRMARRRG LDANTQATIF AWPDVPDGDG       120
     PRKVLSARQQ ALLQATDELI KDRTITAGTW ERLATHLDPR LLIEFCLLAT QYDAIAATIT       180
     ALAIPPDNPQ                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page