(data stored in ACNUC7421 zone)

EMBL: CP001658.PE486

CP001658.PE486       Location/Qualifiers
FT   CDS             563823..565193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00476"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00476"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23507"
FT                   /protein_id="ACT23507.1"
FT                   /translation="MVAHRAEVSGSPPPRLNLSTQPTVARRVRASFAESFAAADPEADA
FT                   ARRMALRRMKVVAVGFLVGATGVFLACRWAQADGADHAWLGYLGAAAEAGMVGALADWF
FT                   AVTALFKHPLGIPIPHTAIIKRKKDQLGEGLGTFVRENFLSPPVVETKLRDAQIPSRLG
FT                   KWLSEATHAQRVAAETATVLRVLVELLRDEDIQQVIDRMIVRRIAEPQWGPPAGRVLAT
FT                   LLAENRQEAFIQLLADRAFQWSLNAGVVIQRVVERDSPSWSPRFIDHLVGDRIHRELME
FT                   FTDKVRRNPDHELRRSATRFLFDFADDLQHDPATVARADAIKEELMARDEIATAAAAAW
FT                   KTLKRLVLEGVDDPSSALRTRITDAVIRIGESLRDDADLRDKVDSWTVRAAQHLVSEYG
FT                   VEITAIITETIERWDAEEASRRIELHVGRDLQFIRINGTVVGAMAGLAIYAIAQLLF"
     MVAHRAEVSG SPPPRLNLST QPTVARRVRA SFAESFAAAD PEADAARRMA LRRMKVVAVG        60
     FLVGATGVFL ACRWAQADGA DHAWLGYLGA AAEAGMVGAL ADWFAVTALF KHPLGIPIPH       120
     TAIIKRKKDQ LGEGLGTFVR ENFLSPPVVE TKLRDAQIPS RLGKWLSEAT HAQRVAAETA       180
     TVLRVLVELL RDEDIQQVID RMIVRRIAEP QWGPPAGRVL ATLLAENRQE AFIQLLADRA       240
     FQWSLNAGVV IQRVVERDSP SWSPRFIDHL VGDRIHRELM EFTDKVRRNP DHELRRSATR       300
     FLFDFADDLQ HDPATVARAD AIKEELMARD EIATAAAAAW KTLKRLVLEG VDDPSSALRT       360
     RITDAVIRIG ESLRDDADLR DKVDSWTVRA AQHLVSEYGV EITAIITETI ERWDAEEASR       420
     RIELHVGRDL QFIRINGTVV GAMAGLAIYA IAQLLF                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page