(data stored in ACNUC7421 zone)

EMBL: CP001658.PE490

CP001658.PE490       Location/Qualifiers
FT   CDS             567035..567481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00480"
FT                   /product="conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23511"
FT                   /protein_id="ACT23511.1"
FT                   /translation="MKALVAVSAVAVVALLGVSSAQADPEADPGAGEANYGGPPSSPRL
FT                   VDHTEWAQWGSLPSLRVYPSQVGRTASRRLGMAAADAAWAEVLALSPEADTAGMRAQFI
FT                   CHWQYAEIRQPGKPSWNLEPWRPVVDDSEMLASGCNPGSPEESF"
     MKALVAVSAV AVVALLGVSS AQADPEADPG AGEANYGGPP SSPRLVDHTE WAQWGSLPSL        60
     RVYPSQVGRT ASRRLGMAAA DAAWAEVLAL SPEADTAGMR AQFICHWQYA EIRQPGKPSW       120
     NLEPWRPVVD DSEMLASGCN PGSPEESF                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page