(data stored in ACNUC7421 zone)

EMBL: CP001658.PE501

CP001658.PE501       Location/Qualifiers
FT   CDS             577846..578472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00491"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23522"
FT                   /protein_id="ACT23522.1"
FT                   /translation="MFVGFVAMMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGA
FT                   LIAAGVGGFAALIHAHPNMTLVARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALI
FT                   GVVQMCLVVTFLNPHVYLDTVVLIGALANEESDLRWFFGAGAWAASVVWFAVLGFSAGR
FT                   LQPFFATPAAWRILDALVAVTMIGVAVVVLVTSPSVPTANVALII"
     MFVGFVAMMT LKVAIGPQNA FVLRQGIRRE YVLVIVALCG IADGALIAAG VGGFAALIHA        60
     HPNMTLVARF GGAAFLIGYA LLAARNAWRP SGLVPSESGP AALIGVVQMC LVVTFLNPHV       120
     YLDTVVLIGA LANEESDLRW FFGAGAWAAS VVWFAVLGFS AGRLQPFFAT PAAWRILDAL       180
     VAVTMIGVAV VVLVTSPSVP TANVALII                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page