(data stored in ACNUC7421 zone)

EMBL: CP001658.PE504

CP001658.PE504       Location/Qualifiers
FT   CDS             complement(580700..580906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00494"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00494"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23525"
FT                   /protein_id="ACT23525.1"
FT                   /translation="MPPPHRYALHRRRRRSSAPLSPASGWCPHLIATLCIVVGAGHRLS
FT                   SSSRCDLFDRSSGSRACSGRSSS"
     MPPPHRYALH RRRRRSSAPL SPASGWCPHL IATLCIVVGA GHRLSSSSRC DLFDRSSGSR        60
     ACSGRSSS                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page