(data stored in ACNUC7421 zone)

EMBL: CP001658.PE505

CP001658.PE505       Location/Qualifiers
FT   CDS             580988..581671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00495"
FT                   /product="two component system sensor protein regX3"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23526"
FT                   /protein_id="ACT23526.1"
FT                   /translation="MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAG
FT                   ADIVLLDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYS
FT                   ARELIARIRAVLRRGGDDDSEMSDGVLESGPVRMDVERHVVSVNGDTITLPLKEFDLLE
FT                   YLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGLG
FT                   YKLEG"
     MTSVLIVEDE ESLADPLAFL LRKEGFEATV VTDGPAALAE FDRAGADIVL LDLMLPGMSG        60
     TDVCKQLRAR SSVPVIMVTA RDSEIDKVVG LELGADDYVT KPYSARELIA RIRAVLRRGG       120
     DDDSEMSDGV LESGPVRMDV ERHVVSVNGD TITLPLKEFD LLEYLMRNSG RVLTRGQLID       180
     RVWGADYVGD TKTLDVHVKR LRSKIEADPA NPVHLVTVRG LGYKLEG                     227
//

If you have problems or comments...

PBIL Back to PBIL home page