(data stored in ACNUC7421 zone)

EMBL: CP001658.PE51

CP001658.PE51        Location/Qualifiers
FT   CDS             55799..57481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00050"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23072"
FT                   /protein_id="ACT23072.1"
FT                   /translation="MTGALSQSSNISPLPLAADLRSADNRDCPSRTDVLGAALANVVGG
FT                   PVGRHALIGRTRLMTPLRVMFAIALVFLALGWSTKAACLQSTGTGPGDQRVANWDNQRA
FT                   YYQLCYSDTVPLYGAELLSQGKFPYKSSWIETDSNGTPQLRYDGQIAVRYMEYPVLTGI
FT                   YQYLSMAIAKTYTALSKVAPLPVVAEVVMFFNVAAFGLALAWLTTVWATSGLAGRRIWD
FT                   AALVAASPLVIFQIFTNFDALATGLATSGLLAWARRRPVLAGVLIGLGSAAKLYPLLFL
FT                   YPLLLLGIRAGRLNALARTMAAAAATWLLVNLPVMLLFPRGWSEFFRLNTRRGDDMDSL
FT                   YNVVKSFTGWRGFDPTLGFWEPPLVLNTVVTLLFVLCCAAIAYIALTAPHRPRVAQLTF
FT                   LTVASFLLVNKVWSPQFSLWLVPLAVLALPHRRILLAWMTIDALVWVPRMYYLYGNPSR
FT                   SLPEQWFTTTVLLRDIAVMVLCGLVVWQIYRPGRDLVRTGGPGALPACGGVDDPVGGVF
FT                   ANAADAPPGRLPSWLRPRLGDEHARERTPDAGRDRTFSGQHRA"
     MTGALSQSSN ISPLPLAADL RSADNRDCPS RTDVLGAALA NVVGGPVGRH ALIGRTRLMT        60
     PLRVMFAIAL VFLALGWSTK AACLQSTGTG PGDQRVANWD NQRAYYQLCY SDTVPLYGAE       120
     LLSQGKFPYK SSWIETDSNG TPQLRYDGQI AVRYMEYPVL TGIYQYLSMA IAKTYTALSK       180
     VAPLPVVAEV VMFFNVAAFG LALAWLTTVW ATSGLAGRRI WDAALVAASP LVIFQIFTNF       240
     DALATGLATS GLLAWARRRP VLAGVLIGLG SAAKLYPLLF LYPLLLLGIR AGRLNALART       300
     MAAAAATWLL VNLPVMLLFP RGWSEFFRLN TRRGDDMDSL YNVVKSFTGW RGFDPTLGFW       360
     EPPLVLNTVV TLLFVLCCAA IAYIALTAPH RPRVAQLTFL TVASFLLVNK VWSPQFSLWL       420
     VPLAVLALPH RRILLAWMTI DALVWVPRMY YLYGNPSRSL PEQWFTTTVL LRDIAVMVLC       480
     GLVVWQIYRP GRDLVRTGGP GALPACGGVD DPVGGVFANA ADAPPGRLPS WLRPRLGDEH       540
     ARERTPDAGR DRTFSGQHRA                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page