(data stored in ACNUC7421 zone)

EMBL: CP001658.PE510

CP001658.PE510       Location/Qualifiers
FT   CDS             complement(585603..586493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23531"
FT                   /protein_id="ACT23531.1"
FT                   /translation="MWRPAQGARWHVPAVLGYGGIPRRASWSNVESVANSRRRPVHPGQ
FT                   EVELDFAREWVEFYDPDNPEHLIAADLTWLLSRWACVFGTPACQGTVAGRPNDGCCSHG
FT                   AFLSDDDDRTRLADAVHKLTDDDWQFRAKGLRRKGYLELDEHDGQPQHRTRKHKGACIF
FT                   LNRPGFAGGAGCALHSKALKLGVPPLTMKPDVCWQLPIRRSQEWVTRPDGTEILKTTLT
FT                   EYDRRGWGSGGADLHWYCTGDPAAHVGTKQVWQSLADELTELLGEKAYGELAAMCKRRS
FT                   QLGLIAVHPATRAAQ"
     MWRPAQGARW HVPAVLGYGG IPRRASWSNV ESVANSRRRP VHPGQEVELD FAREWVEFYD        60
     PDNPEHLIAA DLTWLLSRWA CVFGTPACQG TVAGRPNDGC CSHGAFLSDD DDRTRLADAV       120
     HKLTDDDWQF RAKGLRRKGY LELDEHDGQP QHRTRKHKGA CIFLNRPGFA GGAGCALHSK       180
     ALKLGVPPLT MKPDVCWQLP IRRSQEWVTR PDGTEILKTT LTEYDRRGWG SGGADLHWYC       240
     TGDPAAHVGT KQVWQSLADE LTELLGEKAY GELAAMCKRR SQLGLIAVHP ATRAAQ           296
//

If you have problems or comments...

PBIL Back to PBIL home page