(data stored in ACNUC7421 zone)

EMBL: CP001658.PE511

CP001658.PE511       Location/Qualifiers
FT   CDS             586525..587559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23532"
FT                   /protein_id="ACT23532.1"
FT                   /translation="MRLGVLDVGSNTVHLLVVDAHRGGHPTPMSSTKATLRLAEATDSS
FT                   GKITKRGADKLISTIDEFAKIAISSGCAELMAFATSAVRDAENSEDVLSRVRKETGVEL
FT                   QALRGEDESRLTFLAVRRWYGWSAGRILNLDIGGGSLEVSSGVDEEPEIALSLPLGAGR
FT                   LTREWLPDDPPGRRRVAMLRDWLDAELAEPSVTVLEAGSPDLAVATSKTFRSLARLTGA
FT                   APSMAGPRVKRTLTANGLRQLIAFISRMTAVDRAELEGVSADRAPQIVAGALVAEASMR
FT                   ALSIEAVEICPWALREGLILRKLDSEADGTALIESSSVHTSVRAVGGQPADRNAANRSR
FT                   GSKP"
     MRLGVLDVGS NTVHLLVVDA HRGGHPTPMS STKATLRLAE ATDSSGKITK RGADKLISTI        60
     DEFAKIAISS GCAELMAFAT SAVRDAENSE DVLSRVRKET GVELQALRGE DESRLTFLAV       120
     RRWYGWSAGR ILNLDIGGGS LEVSSGVDEE PEIALSLPLG AGRLTREWLP DDPPGRRRVA       180
     MLRDWLDAEL AEPSVTVLEA GSPDLAVATS KTFRSLARLT GAAPSMAGPR VKRTLTANGL       240
     RQLIAFISRM TAVDRAELEG VSADRAPQIV AGALVAEASM RALSIEAVEI CPWALREGLI       300
     LRKLDSEADG TALIESSSVH TSVRAVGGQP ADRNAANRSR GSKP                        344
//

If you have problems or comments...

PBIL Back to PBIL home page