(data stored in ACNUC7421 zone)

EMBL: CP001658.PE514

CP001658.PE514       Location/Qualifiers
FT   CDS             589362..590237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00504"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23535"
FT                   /protein_id="ACT23535.1"
FT                   /translation="MNALFTTAMALRPLDSDPGNPACRVFEGELNEHWTIGPKVHGGAM
FT                   VALCANAARTAYGAAGQQPMRQPVAVSASFLWAPDPGTMRLVTSIRKRGRRISVADVEL
FT                   TQGGRTAVHAVVTLGEPEHFLPGVDGSGGASGTAPLLSANPVVELMAPEPPEGVVPIGP
FT                   GHQLAGLVHLGEGCDVRPVLSTLRSATDGRPPVIQLWARPRGVAPDALFALLCGDLSAP
FT                   VTFAVDRTGWAPTVALTAYLRALPADGWLRVLCTCVEIGQDWFDEDHIVVDRLGRIVVQ
FT                   TRQLAMVPAQ"
     MNALFTTAMA LRPLDSDPGN PACRVFEGEL NEHWTIGPKV HGGAMVALCA NAARTAYGAA        60
     GQQPMRQPVA VSASFLWAPD PGTMRLVTSI RKRGRRISVA DVELTQGGRT AVHAVVTLGE       120
     PEHFLPGVDG SGGASGTAPL LSANPVVELM APEPPEGVVP IGPGHQLAGL VHLGEGCDVR       180
     PVLSTLRSAT DGRPPVIQLW ARPRGVAPDA LFALLCGDLS APVTFAVDRT GWAPTVALTA       240
     YLRALPADGW LRVLCTCVEI GQDWFDEDHI VVDRLGRIVV QTRQLAMVPA Q                291
//

If you have problems or comments...

PBIL Back to PBIL home page