(data stored in ACNUC7421 zone)

EMBL: CP001658.PE521

CP001658.PE521       Location/Qualifiers
FT   CDS             complement(594981..595481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23542"
FT                   /protein_id="ACT23542.1"
FT                   /translation="MTVPEEAQTLIGKHYRAPDHFLVGREKIREFAVAVKDDHPTHYSE
FT                   PDAAAAGYPALVAPLTFLAIAGRRVQLEIFTKFNIPINIARVFHRDQKFRFHRPILAND
FT                   KLYFDTYLDSVIESHGTVLAEIRSEVTDAEGKPVVTSVVTMLGEAAHHEADADATVAAI
FT                   ASI"
     MTVPEEAQTL IGKHYRAPDH FLVGREKIRE FAVAVKDDHP THYSEPDAAA AGYPALVAPL        60
     TFLAIAGRRV QLEIFTKFNI PINIARVFHR DQKFRFHRPI LANDKLYFDT YLDSVIESHG       120
     TVLAEIRSEV TDAEGKPVVT SVVTMLGEAA HHEADADATV AAIASI                      166
//

If you have problems or comments...

PBIL Back to PBIL home page