(data stored in ACNUC7421 zone)

EMBL: CP001658.PE525

CP001658.PE525       Location/Qualifiers
FT   CDS             600277..600570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23546"
FT                   /protein_id="ACT23546.1"
FT                   /translation="MSRPQVELLTRAGCAICVRVAEQLAELSSELGFDMMTIDVDVAAS
FT                   TGNPGLRAEFGDRLPVVLLDGREHSYWEVDEHRLRADIARSTFGSPPDKRLP"
     MSRPQVELLT RAGCAICVRV AEQLAELSSE LGFDMMTIDV DVAASTGNPG LRAEFGDRLP        60
     VVLLDGREHS YWEVDEHRLR ADIARSTFGS PPDKRLP                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page