(data stored in ACNUC7421 zone)

EMBL: CP001658.PE530

CP001658.PE530       Location/Qualifiers
FT   CDS             605783..606331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00520"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23551"
FT                   /protein_id="ACT23551.1"
FT                   /translation="MTPTGDTKPKLLFYEPGASWYWVLTGPLAAVSVLLLEISSGAGVG
FT                   LITPAIFLVMVSAFVALQVKAARIHTSVELTHDALRQGTETIRLAEIVKIYPEADGRET
FT                   SGEEPAKWQSARTLGELVGVPRGRVGIGLKLTGGRTAQAWARRHQQLRAALTPLVQERL
FT                   GPVDSDVADVNGDDAGPAR"
     MTPTGDTKPK LLFYEPGASW YWVLTGPLAA VSVLLLEISS GAGVGLITPA IFLVMVSAFV        60
     ALQVKAARIH TSVELTHDAL RQGTETIRLA EIVKIYPEAD GRETSGEEPA KWQSARTLGE       120
     LVGVPRGRVG IGLKLTGGRT AQAWARRHQQ LRAALTPLVQ ERLGPVDSDV ADVNGDDAGP       180
     AR                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page