(data stored in ACNUC7421 zone)

EMBL: CP001658.PE535

CP001658.PE535       Location/Qualifiers
FT   CDS             610367..611062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00525"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23556"
FT                   /protein_id="ACT23556.1"
FT                   /translation="MSRPGTYVIGLTLLVGLVVGNPGCPRSYRPLTLDYRLNPVAVIGD
FT                   SYTTGTDEGGLGSKSWTARTWQMLAARGVRIAADVAAEGRAGYGVPGDHGNVFEDLTAR
FT                   AVQPDDALVVFFGSRNDQGMDPEDPEMLAEKVRDTFDLARHRAPSASLLVIAPPWPTAD
FT                   VPGPMLRIRDVLGAQARAAGAVFVDPIADHWFVDRPELIGADGVHPNDAGHEYLADKIA
FT                   PLISMELVG"
     MSRPGTYVIG LTLLVGLVVG NPGCPRSYRP LTLDYRLNPV AVIGDSYTTG TDEGGLGSKS        60
     WTARTWQMLA ARGVRIAADV AAEGRAGYGV PGDHGNVFED LTARAVQPDD ALVVFFGSRN       120
     DQGMDPEDPE MLAEKVRDTF DLARHRAPSA SLLVIAPPWP TADVPGPMLR IRDVLGAQAR       180
     AAGAVFVDPI ADHWFVDRPE LIGADGVHPN DAGHEYLADK IAPLISMELV G                231
//

If you have problems or comments...

PBIL Back to PBIL home page