(data stored in ACNUC7421 zone)

EMBL: CP001658.PE544

CP001658.PE544       Location/Qualifiers
FT   CDS             617672..618451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00534"
FT                   /product="cytochrome C biogenesis protein ccdA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23565"
FT                   /protein_id="ACT23565.1"
FT                   /translation="MTGFTEIAAVGPLLVAVGVCLLAGLVSFASPCVVPLVPGYLSYLA
FT                   AVVGVDEQLPAGVVKPPVAARWRVAGSAALFVAGFTTVFVLGTVAVLGMTTTLITNQLL
FT                   LQRVGGVLIVVMGLVFVGFIGALQRQARFTPRQLTSVAGAPVLGAVFALGWTPCLGPTL
FT                   TGVITVASATEGASVARGIVLVIAYCLGLGIPFVLLAFGSAWAVAGLGWLRRHTRAIQI
FT                   FGGALLIAVGAALVTGVWNDVVSWLRDAFVSDVRLPI"
     MTGFTEIAAV GPLLVAVGVC LLAGLVSFAS PCVVPLVPGY LSYLAAVVGV DEQLPAGVVK        60
     PPVAARWRVA GSAALFVAGF TTVFVLGTVA VLGMTTTLIT NQLLLQRVGG VLIVVMGLVF       120
     VGFIGALQRQ ARFTPRQLTS VAGAPVLGAV FALGWTPCLG PTLTGVITVA SATEGASVAR       180
     GIVLVIAYCL GLGIPFVLLA FGSAWAVAGL GWLRRHTRAI QIFGGALLIA VGAALVTGVW       240
     NDVVSWLRDA FVSDVRLPI                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page