(data stored in ACNUC7421 zone)

EMBL: CP001658.PE545

CP001658.PE545       Location/Qualifiers
FT   CDS             618484..620073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00535"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23566"
FT                   /protein_id="ACT23566.1"
FT                   /translation="MWRSLTSMGTALVLLFLLALAAIPGALLPQRGLNAAKVDDYLAAH
FT                   PLIGPWLDELQAFDVFSSFWFTAIYVLLFVSLVGCLAPRTIEHARSLRATPVAAPRNLA
FT                   RLPKHAHARLAGEPAALAATITGRLRGWRSITRQQGDSVEVSAEKGYLREFGNLVFHFA
FT                   LLGLLVAVAVGKLFGYEGNVIVIADGGPGFCSASPAAFDSFRAGNTVDGTSLHPICVRV
FT                   NNFQAHYLPSGQATSFAADIDYQADPATADLIANSWRPYRLQVNHPLRVGGDRVYLQGH
FT                   GYAPTFTVTFPDGQTRTSTVQWRPDNPQTLLSAGVVRIDPPAGSYPNPDERRKHQIAIQ
FT                   GLLAPTEQLDGTLLSSRFPALNAPAVAIDIYRGDTGLDSGRPQSLFTLDHRLIEQGRLV
FT                   KEKRVNLRAGQQVRIDQGPAAGTVVRFDGAVPFVNLQVSHDPGQSWVLVFAITMMAGLL
FT                   VSLLVRRRRVWARITPTTAGTVNVELGGLTRTDNSGWGAEFERLTGRLLAGFEARSPDM
FT                   AEAAAGTGRDVD"
     MWRSLTSMGT ALVLLFLLAL AAIPGALLPQ RGLNAAKVDD YLAAHPLIGP WLDELQAFDV        60
     FSSFWFTAIY VLLFVSLVGC LAPRTIEHAR SLRATPVAAP RNLARLPKHA HARLAGEPAA       120
     LAATITGRLR GWRSITRQQG DSVEVSAEKG YLREFGNLVF HFALLGLLVA VAVGKLFGYE       180
     GNVIVIADGG PGFCSASPAA FDSFRAGNTV DGTSLHPICV RVNNFQAHYL PSGQATSFAA       240
     DIDYQADPAT ADLIANSWRP YRLQVNHPLR VGGDRVYLQG HGYAPTFTVT FPDGQTRTST       300
     VQWRPDNPQT LLSAGVVRID PPAGSYPNPD ERRKHQIAIQ GLLAPTEQLD GTLLSSRFPA       360
     LNAPAVAIDI YRGDTGLDSG RPQSLFTLDH RLIEQGRLVK EKRVNLRAGQ QVRIDQGPAA       420
     GTVVRFDGAV PFVNLQVSHD PGQSWVLVFA ITMMAGLLVS LLVRRRRVWA RITPTTAGTV       480
     NVELGGLTRT DNSGWGAEFE RLTGRLLAGF EARSPDMAEA AAGTGRDVD                   529
//

If you have problems or comments...

PBIL Back to PBIL home page