(data stored in ACNUC7421 zone)

EMBL: CP001658.PE55

CP001658.PE55        Location/Qualifiers
FT   CDS             59225..59479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00054"
FT                   /product="30S ribosomal protein S18 rpsR1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00054"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23076"
FT                   /protein_id="ACT23076.1"
FT                   /translation="MAKSSKRRPAPEKPVKTRKCVFCAKKDQAIDYKDTALLRTYISER
FT                   GKIRARRVTGNCVQHQRDIALAVKNAREVALLPFTSSVR"
     MAKSSKRRPA PEKPVKTRKC VFCAKKDQAI DYKDTALLRT YISERGKIRA RRVTGNCVQH        60
     QRDIALAVKN AREVALLPFT SSVR                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page