(data stored in ACNUC7421 zone)

EMBL: CP001658.PE550

CP001658.PE550       Location/Qualifiers
FT   CDS             complement(624736..625743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00539"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III
FT                   fabH"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00539"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23571"
FT                   /protein_id="ACT23571.1"
FT                   /translation="MTEIATTSGARSVGLLSVGAYRPERVVTNDEICQHIDSSDEWIYT
FT                   RTGIKTRRFAADDESAASMATEACRRALSNAGLSAADIDGVIVTTNTHFLQTPPAAPMV
FT                   AASLGAKGILGFDLSAGCAGFGYALGAAADMIRGGGAATMLVVGTEKLSPTIDMYDRGN
FT                   CFIFADGAAAVVVGETPFQGIGPTVAGSDGEQADAIRQDIDWITFAQNPSGPRPFVRLE
FT                   GPAVFRWAAFKMGDVGRRAMDAAGVRPDQIDVFVPHQANSRINELLVKNLQLRPDAVVA
FT                   NDIEHTGNTSAASIPLAMAELLTTGAAKPGDLALLIGYGAGLSYAAQVVRMPKG"
     MTEIATTSGA RSVGLLSVGA YRPERVVTND EICQHIDSSD EWIYTRTGIK TRRFAADDES        60
     AASMATEACR RALSNAGLSA ADIDGVIVTT NTHFLQTPPA APMVAASLGA KGILGFDLSA       120
     GCAGFGYALG AAADMIRGGG AATMLVVGTE KLSPTIDMYD RGNCFIFADG AAAVVVGETP       180
     FQGIGPTVAG SDGEQADAIR QDIDWITFAQ NPSGPRPFVR LEGPAVFRWA AFKMGDVGRR       240
     AMDAAGVRPD QIDVFVPHQA NSRINELLVK NLQLRPDAVV ANDIEHTGNT SAASIPLAMA       300
     ELLTTGAAKP GDLALLIGYG AGLSYAAQVV RMPKG                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page