(data stored in ACNUC7421 zone)

EMBL: CP001658.PE554

CP001658.PE554       Location/Qualifiers
FT   CDS             complement(628559..629992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00543"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00543"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23575"
FT                   /protein_id="ACT23575.1"
FT                   /translation="MGLSSDDTRRREVVRDLAAGALLIGALFFPWNLYFGFRIPDSSKT
FT                   VFGLLLAVTSLSLASLAVTFAGRRSQLRLGLNVPYLLLVLAFVVFDAIQTIRLGGTVHV
FT                   PGGVGPGGWLGITGALLSAQPALTGATTDEGSHSRWLRATQFLGYASMLGAALSTGFNL
FT                   SWRVRYALEPAAGASGFGKQNLAVIDTAVVYGVVALAAVLVASRWLLRPTAAEALSTVA
FT                   LGGSTLIAGSIVWSLPIGREIDAFHGIAQNTSTAGVGYEGYLVWAAAAAMCAPLTLFRS
FT                   PNAPPIDKTVWRAASRNGLLLIAVWCLGSVAMRLTDLVVAVLLNYPFSRYDSMALAAFD
FT                   LATAVLAIWLRFNMATEALPARLISSLCGLLCTFTVSRVIVGVVLAPRFQASSGGSAHP
FT                   VYGNDLAQQITSTFDVVLCGLALSILAAAIVIGRLRQLPQPPHTPALSRPAGSPRIFRS
FT                   AGSTHPVRPKIYRPPDHSS"
     MGLSSDDTRR REVVRDLAAG ALLIGALFFP WNLYFGFRIP DSSKTVFGLL LAVTSLSLAS        60
     LAVTFAGRRS QLRLGLNVPY LLLVLAFVVF DAIQTIRLGG TVHVPGGVGP GGWLGITGAL       120
     LSAQPALTGA TTDEGSHSRW LRATQFLGYA SMLGAALSTG FNLSWRVRYA LEPAAGASGF       180
     GKQNLAVIDT AVVYGVVALA AVLVASRWLL RPTAAEALST VALGGSTLIA GSIVWSLPIG       240
     REIDAFHGIA QNTSTAGVGY EGYLVWAAAA AMCAPLTLFR SPNAPPIDKT VWRAASRNGL       300
     LLIAVWCLGS VAMRLTDLVV AVLLNYPFSR YDSMALAAFD LATAVLAIWL RFNMATEALP       360
     ARLISSLCGL LCTFTVSRVI VGVVLAPRFQ ASSGGSAHPV YGNDLAQQIT STFDVVLCGL       420
     ALSILAAAIV IGRLRQLPQP PHTPALSRPA GSPRIFRSAG STHPVRPKIY RPPDHSS          477
//

If you have problems or comments...

PBIL Back to PBIL home page