(data stored in ACNUC7421 zone)

EMBL: CP001658.PE557

CP001658.PE557       Location/Qualifiers
FT   CDS             632633..633295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00546"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23578"
FT                   /protein_id="ACT23578.1"
FT                   /translation="MSCLPVSVLVVAKAPEPGRVKTRLAAAIGDKVAADIAAAALLDTL
FT                   DAVAAAPVTARAVALTGDLDSAADSAEIRRRLKSFTVFRQRGDAFADRLANAHVDAADG
FT                   YPVLQIGMDTPQVTAELLADCARLLLQIPAVLGLAFDGGWWVLGIRTPTAAECLRAVPM
FT                   SQPDTGELTLKALRDNGIDVTLVQRLGDFDIVDDIALVRDCCAPGSRFAQATRAAGL"
     MSCLPVSVLV VAKAPEPGRV KTRLAAAIGD KVAADIAAAA LLDTLDAVAA APVTARAVAL        60
     TGDLDSAADS AEIRRRLKSF TVFRQRGDAF ADRLANAHVD AADGYPVLQI GMDTPQVTAE       120
     LLADCARLLL QIPAVLGLAF DGGWWVLGIR TPTAAECLRA VPMSQPDTGE LTLKALRDNG       180
     IDVTLVQRLG DFDIVDDIAL VRDCCAPGSR FAQATRAAGL                             220
//

If you have problems or comments...

PBIL Back to PBIL home page