(data stored in ACNUC7421 zone)

EMBL: CP001658.PE56

CP001658.PE56        Location/Qualifiers
FT   CDS             59512..59970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00055"
FT                   /product="50S ribosomal protein L9 rplI"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23077"
FT                   /protein_id="ACT23077.1"
FT                   /translation="MKLILTADVDHLGSIGDTVEVKDGYGRNFLLPRGLAIVASRGAQK
FT                   QADEIRRARETKSVRDLEHANEIKAAIEALGPIALPVKTSADSGKLFGSVTAADVVAAI
FT                   KKAGGPNLDKRIVRLPKTHIKAVGTHFVSVHLHPEIDVEVSLDVVAQS"
     MKLILTADVD HLGSIGDTVE VKDGYGRNFL LPRGLAIVAS RGAQKQADEI RRARETKSVR        60
     DLEHANEIKA AIEALGPIAL PVKTSADSGK LFGSVTAADV VAAIKKAGGP NLDKRIVRLP       120
     KTHIKAVGTH FVSVHLHPEI DVEVSLDVVA QS                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page