(data stored in ACNUC7421 zone)

EMBL: CP001658.PE563

CP001658.PE563       Location/Qualifiers
FT   CDS             complement(637844..638230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00552"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23584"
FT                   /protein_id="ACT23584.1"
FT                   /translation="MEILASRMLLRPADYQRSLSFYRDQIGLAIAREYGAGTVFFAGQS
FT                   LLELAGYGEPDHSRGPFPGALWLQVRDLEATQTELVSRGVSIAREPRREPWGLHEMHVT
FT                   DPDGITLIFVEVPEGHPLRTDTRA"
     MEILASRMLL RPADYQRSLS FYRDQIGLAI AREYGAGTVF FAGQSLLELA GYGEPDHSRG        60
     PFPGALWLQV RDLEATQTEL VSRGVSIARE PRREPWGLHE MHVTDPDGIT LIFVEVPEGH       120
     PLRTDTRA                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page